galaxy-dev September 2012

galaxy-dev@lists.galaxyproject.org

82 participants
160 discussions

Displaying genomic sequences in Trackster
by Naharajan Lakshmanaperumal 24 May '13

24 May '13

Dear all, We have our own galaxy instance and the idea is to have trackster enabled for users to be able to visualize NGS mapping. We were able to configure trackster in our instance and the visualization works fine. We have two questions regarding trackster: 1) We can't display genomic sequences in trackster. As per the tutorial, we set the location of the .2bit file in the twobit.loc file for the trackster to be able to display the genomic sequence but for some reason it doesn't display it. The name of the builds is the same in all places i.e) in ucsc/chrom/builds.txt and also in the .loc files. Any ideas on what else should be done? 2) While saving the visualization, there is always an error message saying "could not save visualization" and it doesn't seem to be a web browser issue. How do we then save the visualization? Thanks in advance, Naharajan

3 4

Difficulties using <repeat> tagset with min attribute
by Cory Spencer 08 May '13

08 May '13

Hi all - I've been trying to get the <repeat>...</repeat> tag working with a min attribute for some time now, though without any success. It works in other tools distributed with Galaxy, but when I attempt to use it in one of our custom tools, it dies with a "AttributeError: 'ExpressionContext' object has no attribute 'keys'" exception. Can anybody offer any insight? The full traceback is: ⇝ AttributeError: 'ExpressionContext' object has no attribute 'keys' URL: http://localhost:8080/tool_runner?tool_id=scde-list-compare Module weberror.evalexception.middleware:364 in respond view >> app_iter = self.application(environ, detect_start_response) Module paste.debug.prints:98 in __call__ view >> environ, self.app) Module paste.wsgilib:539 in intercept_output view >> app_iter = application(environ, replacement_start_response) Module paste.recursive:80 in __call__ view >> return self.application(environ, start_response) Module paste.httpexceptions:632 in __call__ view >> return self.application(environ, start_response) Module galaxy.web.framework.base:160 in __call__ view >> body = method( trans, **kwargs ) Module galaxy.web.controllers.tool_runner:68 in index view >> template, vars = tool.handle_input( trans, params.__dict__ ) Module galaxy.tools:1320 in handle_input view >> state = self.new_state( trans ) Module galaxy.tools:1248 in new_state view >> self.fill_in_new_state( trans, inputs, state.inputs ) Module galaxy.tools:1257 in fill_in_new_state view >> state[ input.name ] = input.get_initial_value( trans, context ) Module galaxy.tools.parameters.grouping:100 in get_initial_value view >> rval_dict[ input.name ] = input.get_initial_value( trans, context ) Module galaxy.tools.parameters.basic:1016 in get_initial_value view >> return SelectToolParameter.get_initial_value( self, trans, context ) Module galaxy.tools.parameters.basic:785 in get_initial_value view >> if self.need_late_validation( trans, context ): Module galaxy.tools.parameters.basic:1022 in need_late_validation view >> if super( ColumnListParameter, self ).need_late_validation( trans, context ): Module galaxy.tools.parameters.basic:766 in need_late_validation view >> for layer in context.itervalues(): Module UserDict:116 in itervalues view >> for _, v in self.iteritems(): Module UserDict:109 in iteritems view >> for k in self: Module UserDict:96 in __iter__ view >> for k in self.keys(): AttributeError: 'ExpressionContext' object has no attribute 'keys'

2 2

Conditional tool options based on input file format?
by Peter Cock 06 May '13

06 May '13

Dear all, I've looked over the wiki and as far as I can see, 'when' tags used inside 'conditional' tags only work on another input variable's values. I would like to be able to do is a conditional based on the file format of an input file. For instance, a tool might take XML or tabular files, and need to show additional parameters for one input type but not the other. Does this enhancement idea seem useful? Peter

4 6

Puzzling test failure with data_column parameter
by Peter Cock 24 Apr '13

24 Apr '13

Hi all, I'm working on a FASTA filter script, as per this email: http://lists.bx.psu.edu/pipermail/galaxy-dev/2010-November/003819.html Current code here: http://bitbucket.org/peterjc/galaxy-central/src/c3ac6d7a02f7/ I've added a basic test, but it won't run (see output below). I think the interesting bit of the error output is this exception: cannot find value/label "blastp_four_human_vs_rhodopsin.tabular" in list control, coming from function set_form_control_value in the twill.utils module. This is something to do with the columns parameter, a multiselect option referencing the columns in this tabular file. Removing the validator makes no difference. However, if I change the columns parameter to a plain text parameter, the test passes: $ hg diff diff -r c3ac6d7a02f7 tools/fasta_tools/fasta_filter_by_id.xml --- a/tools/fasta_tools/fasta_filter_by_id.xml Tue Nov 23 11:37:35 2010 +0000 +++ b/tools/fasta_tools/fasta_filter_by_id.xml Tue Nov 23 14:03:31 2010 +0000 @@ -4,9 +4,7 @@ <inputs> <param name="input_fasta" type="data" format="fasta" label="FASTA file to filter on the identifiers"/> <param name="input_tabular" type="data" format="tabular" label="Tabular file containing FASTA identifiers"/> - <param name="columns" type="data_column" data_ref="input_tabular" multiple="True" numerical="False" label="Column(s) containing FASTA identifiers" help="Multi-select list - hold the appropriate key while clicking to select multiple columns"> - <validator type="no_options" message="Pick at least one column"/> - </param> + <param name="columns" type="text" label="Column(s) containing FASTA identifiers" /> </inputs> <outputs> <data name="output_pos" format="fasta" label="With matched ID" /> I've tried searching the provided wrappers for similar examples (column multi-select from a tabular file). I found filters/uniq.xml (works but uses a bed file rather than a simple tabular file) and stats/cor.xml (needs R and rpy which I don't have installed yet) which have tests, and finally plotting/bar_chart.xml which has no unit tests. Would someone familiar with the internals of the Galaxy tests and how they set tool parameters be able to try reproducing this for me? The branch has all the unit test files required, and there are no new dependencies needed. Thank you, Peter -- Here is the output (on Linux - other tests tried pass): $ ./run_functional_tests.sh -id fasta_filter_by_id ... nose.plugins.manager DEBUG 2010-11-23 13:59:32,958 DefaultPluginManager load plugin sqlalchemy = sqlalchemy.test.noseplugin:NoseSQLAlchemy nose.plugins.manager DEBUG 2010-11-23 13:59:32,961 DefaultPluginManager load plugin nosetestdiff = nosetestdiff.plugin:NoseTestDiff nose.plugins.manager DEBUG 2010-11-23 13:59:32,962 DefaultPluginManager load plugin nosehtml = nosehtml.plugin:NoseHTML Filter sequences by ID ( fasta_filter_by_id ) > Test-1 ... galaxy.tools.actions.upload_common INFO 2010-11-23 13:59:34,905 tool upload1 created job id 1 galaxy.jobs DEBUG 2010-11-23 13:59:42,709 dispatching job 1 to local runner galaxy.jobs INFO 2010-11-23 13:59:42,899 job 1 dispatched galaxy.jobs.runners.local DEBUG 2010-11-23 13:59:43,213 executing: python /home/pjcock/repositories/galaxy-central/tools/data_source/upload.py /home/pjcock/repositories/galaxy-central /home/pjcock/repositories/galaxy-central/datatypes_conf.xml /tmp/tmpOVlriT 1:/home/pjcock/repositories/galaxy-central/database/job_working_directory/1/dataset_1_files:/tmp/tmpu4uu_o/database/files/000/dataset_1.dat galaxy.jobs.runners.local DEBUG 2010-11-23 13:59:44,033 execution finished: python /home/pjcock/repositories/galaxy-central/tools/data_source/upload.py /home/pjcock/repositories/galaxy-central /home/pjcock/repositories/galaxy-central/datatypes_conf.xml /tmp/tmpOVlriT 1:/home/pjcock/repositories/galaxy-central/database/job_working_directory/1/dataset_1_files:/tmp/tmpu4uu_o/database/files/000/dataset_1.dat galaxy.jobs DEBUG 2010-11-23 13:59:44,414 job 1 ended galaxy.tools.actions.upload_common INFO 2010-11-23 13:59:49,927 tool upload1 created job id 2 galaxy.jobs DEBUG 2010-11-23 13:59:50,067 dispatching job 2 to local runner galaxy.jobs INFO 2010-11-23 13:59:50,702 job 2 dispatched galaxy.jobs.runners.local DEBUG 2010-11-23 13:59:52,059 executing: python /home/pjcock/repositories/galaxy-central/tools/data_source/upload.py /home/pjcock/repositories/galaxy-central /home/pjcock/repositories/galaxy-central/datatypes_conf.xml /tmp/tmp6Z76yl 2:/home/pjcock/repositories/galaxy-central/database/job_working_directory/2/dataset_2_files:/tmp/tmpu4uu_o/database/files/000/dataset_2.dat galaxy.jobs.runners.local DEBUG 2010-11-23 13:59:52,874 execution finished: python /home/pjcock/repositories/galaxy-central/tools/data_source/upload.py /home/pjcock/repositories/galaxy-central /home/pjcock/repositories/galaxy-central/datatypes_conf.xml /tmp/tmp6Z76yl 2:/home/pjcock/repositories/galaxy-central/database/job_working_directory/2/dataset_2_files:/tmp/tmpu4uu_o/database/files/000/dataset_2.dat galaxy.jobs DEBUG 2010-11-23 13:59:53,420 job 2 ended base.twilltestcase DEBUG 2010-11-23 13:59:53,747 In submit_form, continuing, but caught exception: cannot find value/label "blastp_four_human_vs_rhodopsin.tabular" in list control base.twilltestcase DEBUG 2010-11-23 13:59:54,488 ## files diff on /home/pjcock/repositories/galaxy-central/test-data/four_human_proteins_filter_a.fasta and /tmp/tmpijWxYGfour_human_proteins_filter_a.fasta lines_diff=0, found diff = 61 FAIL ====================================================================== FAIL: Filter sequences by ID ( fasta_filter_by_id ) > Test-1 ---------------------------------------------------------------------- Traceback (most recent call last): File "/home/pjcock/repositories/galaxy-central/test/functional/test_toolbox.py", line 160, in test_tool self.do_it( td ) File "/home/pjcock/repositories/galaxy-central/test/functional/test_toolbox.py", line 101, in do_it self.verify_dataset_correctness( outfile, hid=elem_hid, maxseconds=testdef.maxseconds, attributes=attributes ) File "/home/pjcock/repositories/galaxy-central/test/base/twilltestcase.py", line 656, in verify_dataset_correctness raise AssertionError( errmsg ) AssertionError: History item 1 different than expected, difference (using diff): --- local_file +++ history_data @@ -1,2 +1,61 @@ +>sp|Q9BS26|ERP44_HUMAN Endoplasmic reticulum resident protein 44 OS=Homo sapiens GN=ERP44 PE=1 SV=1 +MHPAVFLSLPDLRCSLLLLVTWVFTPVTTEITSLDTENIDEILNNADVALVNFYADWCRF +SQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMK +REYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFER +VANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDK +CVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHAD +CDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREF +HHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL +>sp|Q9NSY1|BMP2K_HUMAN BMP-2-inducible protein kinase OS=Homo sapiens GN=BMP2K PE=1 SV=2 +MKKFSRMPKSEGGSGGGAAGGGAGGAGAGAGCGSGGSSVGVRVFAVGRHQVTLEESLAEG +GFSTVFLVRTHGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSIS +DNVWEVLILMEYCRAGQVVNQMNKKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRD +LKVENILLNDGGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGG +KPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPDNSRYSRNIHCLIRFMLEP +DPEHRPDIFQVSYFAFKFAKKDCPVSNINNSSIPSALPEPMTASEAAARKSQIKARITDT +IGPTETSIAPRQRPKANSATTATPSVLTIQSSATPVKVLAPGEFGNHRPKGALRPGNGPE +ILLGQGPPQQPPQQHRVLQQLQQGDWRLQQLHLQHRHPHQQQQQQQQQQQQQQQQQQQQQ +QQQQQQHHHHHHHHLLQDAYMQQYQHATQQQQMLQQQFLMHSVYQPQPSASQYPTMMPQY +QQAFFQQQMLAQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV +ADKEAIANFTNQKNISNPPDMSGWNPFGEDNFSKLTEEELLDREFDLLRSNRLEERASSD +KNVDSLSAPHNHPPEDPFGSVPFISHSGSPEKKAEHSSINQENGTANPIKNGKTSPASKD +QRTGKKTSVQGQVQKGNDESESDFESDPPSPKSSEEEEQDDEEVLQGEQGDFNDDDTEPE +NLGHRPLLMDSEDEEEEEKHSSDSDYEQAKAKYSDMSSVYRDRSGSGPTQDLNTILLTSA +QLSSDVAVETPKQEFDVFGAVPFFAVRAQQPQQEKNEKNLPQHRFPAAGLEQEEFDVFTK +APFSKKVNVQECHAVGPEAHTIPGYPKSVDVFGSTPFQPFLTSTSKSESNEDLFGLVPFD +EITGSQQQKVKQRSLQKLSSRQRRTKQDMSKSNGKRHHGTPTSTKKTLKPTYRTPERARR +HKKVGRRDSQSSNEFLTISDSKENISVALTDGKDRGNVLQPEESLLDPFGAKPFHSPDLS +WHPPHQGLSDIRADHNTVLPGRPRQNSLHGSFHSADVLKMDDFGAVPFTELVVQSITPHQ +SQQSQPVELDPFGAAPFPSKQ +>sp|P06213|INSR_HUMAN Insulin receptor OS=Homo sapiens GN=INSR PE=1 SV=4 +MATGGRRGAAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL +QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL +VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE +ECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECL +GNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQG +CHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGC +TVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL -------------------- >> begin captured stdout << --------------------- Uploaded file: four_human_proteins.fasta , ftype: fasta , extra: {'ftype': 'fasta', 'value': 'four_human_proteins.fasta', 'children': []} Uploaded file: blastp_four_human_vs_rhodopsin.tabular , ftype: tabular , extra: {'ftype': 'tabular', 'value': 'blastp_four_human_vs_rhodopsin.tabular', 'children': []} form 'tool_form' contains the following controls ( note the values ) control 0: <HiddenControl(tool_id=fasta_filter_by_id) (readonly)> control 1: <HiddenControl(tool_state=800255c1626362313139396662383639346664316133316565303361646336323163663764636566333538623a376232323566356637303631363736353566356632323361323033303263323032323639366537303735373435663636363137333734363132323361323032323331323232633230323236333666366337353664366537333232336132303232366537353663366332323263323032323639366537303735373435663734363136323735366336313732323233613230323233323232376471002e) (readonly)> control 2: <SelectControl(input_fasta=[*1])> control 3: <SelectControl(input_tabular=[*2])> control 4: <SelectControl(columns=[1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12])> control 5: <SubmitControl(runtool_btn=Execute) (readonly)> page_inputs (0) {'input_fasta': ['four_human_proteins.fasta'], 'columns': ['1'], 'input_tabular': ['blastp_four_human_vs_rhodopsin.tabular']} --------------------- >> end captured stdout << ---------------------- -------------------- >> begin captured logging << -------------------- galaxy.tools.actions.upload_common: INFO: tool upload1 created job id 1 galaxy.jobs: DEBUG: dispatching job 1 to local runner galaxy.jobs: INFO: job 1 dispatched galaxy.jobs.runners.local: DEBUG: executing: python /home/pjcock/repositories/galaxy-central/tools/data_source/upload.py /home/pjcock/repositories/galaxy-central /home/pjcock/repositories/galaxy-central/datatypes_conf.xml /tmp/tmpOVlriT 1:/home/pjcock/repositories/galaxy-central/database/job_working_directory/1/dataset_1_files:/tmp/tmpu4uu_o/database/files/000/dataset_1.dat galaxy.jobs.runners.local: DEBUG: execution finished: python /home/pjcock/repositories/galaxy-central/tools/data_source/upload.py /home/pjcock/repositories/galaxy-central /home/pjcock/repositories/galaxy-central/datatypes_conf.xml /tmp/tmpOVlriT 1:/home/pjcock/repositories/galaxy-central/database/job_working_directory/1/dataset_1_files:/tmp/tmpu4uu_o/database/files/000/dataset_1.dat galaxy.jobs: DEBUG: job 1 ended galaxy.tools.actions.upload_common: INFO: tool upload1 created job id 2 galaxy.jobs: DEBUG: dispatching job 2 to local runner galaxy.jobs: INFO: job 2 dispatched galaxy.jobs.runners.local: DEBUG: executing: python /home/pjcock/repositories/galaxy-central/tools/data_source/upload.py /home/pjcock/repositories/galaxy-central /home/pjcock/repositories/galaxy-central/datatypes_conf.xml /tmp/tmp6Z76yl 2:/home/pjcock/repositories/galaxy-central/database/job_working_directory/2/dataset_2_files:/tmp/tmpu4uu_o/database/files/000/dataset_2.dat galaxy.jobs.runners.local: DEBUG: execution finished: python /home/pjcock/repositories/galaxy-central/tools/data_source/upload.py /home/pjcock/repositories/galaxy-central /home/pjcock/repositories/galaxy-central/datatypes_conf.xml /tmp/tmp6Z76yl 2:/home/pjcock/repositories/galaxy-central/database/job_working_directory/2/dataset_2_files:/tmp/tmpu4uu_o/database/files/000/dataset_2.dat galaxy.jobs: DEBUG: job 2 ended base.twilltestcase: DEBUG: In submit_form, continuing, but caught exception: cannot find value/label "blastp_four_human_vs_rhodopsin.tabular" in list control base.twilltestcase: DEBUG: ## files diff on /home/pjcock/repositories/galaxy-central/test-data/four_human_proteins_filter_a.fasta and /tmp/tmpijWxYGfour_human_proteins_filter_a.fasta lines_diff=0, found diff = 61 --------------------- >> end captured logging << --------------------- ---------------------------------------------------------------------- Ran 1 test in 21.504s FAILED (failures=1) functional_tests.py INFO 2010-11-23 13:59:54,494 Shutting down functional_tests.py INFO 2010-11-23 13:59:54,494 Shutting down embedded web server functional_tests.py INFO 2010-11-23 13:59:54,497 Embedded web server stopped functional_tests.py INFO 2010-11-23 13:59:54,497 Shutting down app galaxy.jobs INFO 2010-11-23 13:59:54,497 sending stop signal to worker thread galaxy.jobs INFO 2010-11-23 13:59:54,498 job queue stopped galaxy.jobs.runners.local INFO 2010-11-23 13:59:54,498 sending stop signal to worker threads galaxy.jobs.runners.local INFO 2010-11-23 13:59:54,498 local job runner stopped galaxy.jobs INFO 2010-11-23 13:59:54,499 sending stop signal to worker thread galaxy.jobs INFO 2010-11-23 13:59:54,499 job stopper stopped functional_tests.py INFO 2010-11-23 13:59:54,499 Embedded Universe application stopped functional_tests.py INFO 2010-11-23 13:59:54,500 Cleaning up temporary files in /tmp/tmpu4uu_o galaxy.jobs INFO 2010-11-23 13:59:55,410 sending stop signal to worker thread galaxy.jobs INFO 2010-11-23 13:59:55,411 job queue stopped galaxy.jobs.runners.local INFO 2010-11-23 13:59:55,411 sending stop signal to worker threads galaxy.jobs.runners.local INFO 2010-11-23 13:59:55,411 local job runner stopped galaxy.jobs INFO 2010-11-23 13:59:55,411 sending stop signal to worker thread galaxy.jobs INFO 2010-11-23 13:59:55,412 job stopper stopped 'run_functional_tests.sh help' for help Note: galaxy test framework uses tool_conf.xml.sample, not tool_conf.xml

2 3

resubmit a job if the node fails
by zhengqiu cai 10 Apr '13

10 Apr '13

Hi, Can Galaxy resubmit a job if the node where the job is running fails? I know sge can do that by using qsub -r. It should be very useful if Galaxy can do that. Thank you, Cai

3 2

Tabular file metadata - columns names
by Peter 22 Feb '13

22 Feb '13

Hi all, I'd like to know more about Galaxy's column metadata for tabular files. In the workflow editor under "Edit Step Actions" you can pick "Assign Columns", and then give column numbers for five predefined cases: Chrom, Start, End, Strand, Name. Do these "named columns" get shown anywhere in the Galaxy UI? For example, in a column select parameter widget? Is it possible to assign these columns in a tool's wrapper XML file? >From http://bitbucket.org/galaxy/galaxy-central/wiki/ToolConfigSyntax I'm aware of the metadata_source attribute to *copy* the meta data from the input file, but that isn't always relevant. Can I somehow specify that my tool has tabular output where column 1 is "Name"? Is it possible to introduce additional column types? e.g. "evalue" or "Description". Thanks, Peter

3 7

environment variables and paths for toolshed tools
by David Hoover 20 Feb '13

20 Feb '13

Are there any environment variables that are honored by toolshed installed tools? I tried creating a tool that uses ${GALAXY_DATA_INDEX_DIR} or $GALAXY_HOME, then uploaded it the test toolshed, then installed it automatically. Neither of these resolved to what I expected. I don't want to hard-code the path in the xml tool file, but rather have a default location for other executables and jar files. How should this best be done? David Hoover Helix Systems Staff

3 14

run_functional_tests.sh -sid option
by Peter 11 Feb '13

11 Feb '13

Hi, I'm trying to use run_functional_tests.sh to run all the tests for a section (group of tools). I've read the output from: ./run_functional_tests.sh help For example, from the tools_conf.xml.sample we have <section name="ENCODE Tools" id="EncodeTools"> <tool file="encode/gencode_partition.xml" /> <tool file="encode/random_intervals.xml" /> </section> And looking at these tools' XML files, <tool id="gencode_partition1" name="Gencode Partition"> and: <tool id="random_intervals1" name="Random Intervals"> I'd like to run the functional tests for the ENCODE tools, Using the switch for an individual tool id (-id) works, ./run_functional_tests.sh -id gencode_partition1 ... Ran 1 test in 22.302s ... and so does this (well, it say the tool doesn't have any tests which is true in this example): ./run_functional_tests.sh -id random_intervals1 ... Ran 1 test in 0.027s ... However, I also tried using the section id switch (-sid), ./run_functional_tests.sh -sid EncodeTools ... Ran 0 tests in 0.000s ... I also tried using the section name, /run_functional_tests.sh -sid "ENCODE Tools" Is this (-sid not working) a known issue, or am I using it wrong? Thanks, Peter

4 5

Visualise Galaxy workflows using graphviz
by Peter van Heusden 21 Jan '13

21 Jan '13

Hi there Because my Galaxy workflows tend to sprawl outside the viewable space in my browser, I've written a script that, when given a workflow JSON file as input, writes out a graphviz dot format graph of the workflow. By default the graph treats datasets as nodes and analyses as edges (unlike the Galaxy workflow editor, but quite like the way the history is presented), but you can choose to have analyses as nodes (and thus datasets as edges) too. In case anyone else finds this useful, the code can be downloaded from my bitbucket: https://bitbucket.org/pvanheus/galaxy/src/f29453f3d9d8/contrib/workflow_to_… Usage is something like: ./workflow_to_dot.py Galaxy-Workflow.ga |dot -Tsvg >workflow.svg and then you can view your workflow.svg with eog or another viewer. Peter

3 3

Job output not returned from Cluster
by Sascha Kastens 17 Jan '13

17 Jan '13

Hi all, I have exactly the same problem as described here: http://gmod.827538.n3.nabble.com/Job-output-not-returned-from-cluster-td879… All the SGE stuff is administrated in our company and unfortunately they know nothing about Galaxy and so it?s my task to get it running. Everything works fine except the problem mentioned above. I?ve contacted Erick but haven?t received a response yet. If anybody can give me some hints where I can look at to solve the problem or at least what I can tell the admins, I would be really grateful. Thanks in advance. If you need further information let me know! Cheers, Sascha

4 8

Jump to page:

2024

2023

2022

2021

2020

2019

2018

2017

2016

2015

2014

2013

2012

2011

2010

2009

2008

galaxy-dev September 2012